SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG575_internal:A_BomoMG_comp18733_c0_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC101742325_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007420 P brain development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0030517 P negative regulation of axon extension
GO:0032482 P Rab protein signal transduction
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042995 C cell projection
GO:0044295 C axonal growth cone
GO:0046777 P protein autophosphorylation
GO:0048471 C perinuclear region of cytoplasm
GO:0051402 P neuron apoptotic process
GO:0055037 C recycling endosome
RNA-seq EntryA_BomoMG_comp18733_c0_seq1
Sequence
(Amino Acid)
LNSRGHLYGNLWSGNVLVRGEADNARAVLGRYTNAESPYEHDAPETRRHPPLYTASSEVW
FLGNLIWEVCAWGATPVALPPPLPDLPCPYRNHLYQVMQLCWNTNPDARPTSAQVHGLID
HLYTSHTETTELSQDGSFGTSDFEERWQRLKPNTIPKIDEHVAIV
(54 a.a.)

- SilkBase 1999-2023 -