SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG569_3prime_partial:A_BomoMG_comp18694_c0_seq2
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		hypothetical_protein_KGM_06737_[Danaus_plexippus]
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0001764 P neuron migration
GO:0002076 P osteoblast development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0009880 P embryonic pattern specification
GO:0010468 P regulation of gene expression
GO:0016363 C nuclear matrix
GO:0016568 P chromatin organization
GO:0021902 P commitment of neuronal cell to specific neuron type in forebrain
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048704 P embryonic skeletal system morphogenesis
GO:0051216 P cartilage development
GO:0060021 P roof of mouth development
GO:0071310 P cellular response to organic substance
RNA-seq EntryA_BomoMG_comp18694_c0_seq2
Sequence
(Amino Acid)
MRLGYPHELAASAKGSVVINNWKPLPFERISDGPLATVGEVLGELTTVATLRIQLLRPRP
TPLQDIKDKLLRLLLVQSRPLLMSTGCPLDEITLAQICRGQDRTPGPHNFHEPSEDMRRK
FESWWTAQVSPRPPPFSPRRYPSPGPKNRSPT
(49 a.a.)

- SilkBase 1999-2023 -