| Name | O_BomoMG560_internal:A_BomoMG_comp18664_c0_seq1 |
| Scaffold_id | Bomo_Chr17 |
NCBI non-redundant
(nr) | PREDICTED:_NAD-dependent_protein_deacetylase_sirtuin-6_[Bombyx_mori] |
| Ontology |
| GO:0000122 |
P |
negative regulation of transcription by RNA polymerase II |
| GO:0003674 |
F |
molecular_function |
| GO:0003682 |
F |
chromatin binding |
| GO:0005575 |
C |
cellular_component |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0005731 |
C |
nucleolus organizer region |
| GO:0005737 |
C |
cytoplasm |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0007072 |
P |
positive regulation of transcription involved in exit from mitosis |
| GO:0008150 |
P |
biological_process |
| GO:0009303 |
P |
rRNA transcription |
| GO:0016568 |
P |
chromatin organization |
| GO:0016787 |
F |
hydrolase activity |
| GO:0046872 |
F |
metal ion binding |
| GO:0070403 |
F |
NAD+ binding |
| GO:0070932 |
P |
histone H3 deacetylation |
| GO:0070933 |
P |
histone H4 deacetylation |
| GO:0097372 |
F |
NAD-dependent histone deacetylase activity (H3-K18 specific) |
|
| RNA-seq Entry | A_BomoMG_comp18664_c0_seq1 |
Sequence
(Amino Acid) | GALRHAARADVVLCLGSSLKVLRRYGRLWRMHSAPSSRPALYIVNLQWTPKDSVAKLKIN
ARCDTVMRQVARRLRLRVPRYDSPRDPVIWHAEPLAAPEAHTTRRSPLRDDPASDGSPYH
TDASSPSASDSDEEVPLRRLAD
(46 a.a.) |
