SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG526_internal:A_BomoMG_comp18570_c1_seq1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		hemolymph_protein_14_[Bombyx_mori]
Ontology
GO:0003279 P cardiac septum development
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005765 C lysosomal membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005905 C clathrin-coated pit
GO:0005925 C focal adhesion
GO:0006897 P endocytosis
GO:0006898 P receptor-mediated endocytosis
GO:0007275 P multicellular organism development
GO:0008203 P cholesterol metabolic process
GO:0010875 P positive regulation of cholesterol efflux
GO:0014912 P negative regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0032370 P positive regulation of lipid transport
GO:0032374 P regulation of cholesterol transport
GO:0032403 F protein-containing complex binding
GO:0032429 P regulation of phospholipase A2 activity
GO:0032956 P regulation of actin cytoskeleton organization
GO:0034185 F apolipoprotein binding
GO:0035909 P aorta morphogenesis
GO:0043235 C receptor complex
GO:0043277 P apoptotic cell clearance
GO:0044822 F RNA binding
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0060976 P coronary vasculature development
GO:0097242 P amyloid-beta clearance
GO:2000587 P negative regulation of platelet-derived growth factor receptor-beta signaling pathway
RNA-seq EntryA_BomoMG_comp18570_c1_seq1
Sequence
(Amino Acid)
CTYGACVDGTAPCNGIQECADNSDELLPQCRGNEVADATNLRDKFKCADGNVIPATAFCD
GVADCPDGSDETVQACAGRTCPAYLFQCAYGACVDAGSDCNGIKECADGSDESDELCDRV
LSGKPTQKPSASGGCVLPQYPAHGSYVVLNTPNATPGQTFDSIQVNVTCKPGYGVMGRND
VFCLNGWWSDKLPQCVRFCTLNSHASVEYKCLLTNGNEGTRPCGSLEPTGTIVQPQCRSP
NYYSTVPLGYMRCIEGNWDYVATCTPGLSRNGTNVTVLIKDKVEIYISNLEYT
(96 a.a.)

- SilkBase 1999-2023 -