SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG34_internal:A_BomoMG_comp17002_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		protein_kinase_ASK1_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0000187 P obsolete activation of MAPK activity
GO:0000287 F magnesium ion binding
GO:0001934 P positive regulation of protein phosphorylation
GO:0002376 P immune system process
GO:0002931 P response to ischemia
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004709 F MAP kinase kinase kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007254 P JNK cascade
GO:0007257 P obsolete activation of JUN kinase activity
GO:0008631 P intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0010941 P regulation of cell death
GO:0016032 P viral process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0034976 P response to endoplasmic reticulum stress
GO:0038066 P p38MAPK cascade
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043507 P positive regulation of JUN kinase activity
GO:0045087 P innate immune response
GO:0045663 P positive regulation of myoblast differentiation
GO:0046330 P positive regulation of JNK cascade
GO:0046872 F metal ion binding
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070301 P cellular response to hydrogen peroxide
GO:0097190 P apoptotic signaling pathway
GO:0097300 P programmed necrotic cell death
GO:1901216 P positive regulation of neuron death
GO:1902170 P cellular response to reactive nitrogen species
GO:1902911 C protein kinase complex
GO:1990604 C IRE1-TRAF2-ASK1 complex
RNA-seq EntryA_BomoMG_comp17002_c0_seq1
Sequence
(Amino Acid)
TNASSALEDTGEVRSICESVCSDSSNATVQPGGSNQRPRMDIACVLDVSHTSNISHRKRA
LEEVRLAAELVNANLHHIHFEKLDFGETNVLDTFYNADVALVDLSVQLQQSSLLYHLGVR
ESFDMKENVLLYNDVDPDSTLRLKISLPNFLFVSYKLTDVGTCVTTNPAATKFKGEDSA
(58 a.a.)

- SilkBase 1999-2023 -