SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG336_5prime_partial:A_BomoMG_comp17739_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
PREDICTED:_E3_ubiquitin-protein_ligase_LRSAM1-like_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005876 C spindle microtubule
GO:0006915 P apoptotic process
GO:0007166 P cell surface receptor signaling pathway
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007283 P spermatogenesis
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0010803 P regulation of tumor necrosis factor-mediated signaling pathway
GO:0010939 P regulation of necrotic cell death
GO:0016567 P protein ubiquitination
GO:0016740 F transferase activity
GO:0016874 F ligase activity
GO:0031398 P positive regulation of protein ubiquitination
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0034121 P regulation of toll-like receptor signaling pathway
GO:0035666 P TRIF-dependent toll-like receptor signaling pathway
GO:0038061 P NIK/NF-kappaB signaling
GO:0039535 P regulation of RIG-I signaling pathway
GO:0042981 P regulation of apoptotic process
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043234 C protein-containing complex
GO:0045088 P regulation of innate immune response
GO:0045121 C membrane raft
GO:0046872 F metal ion binding
GO:0050727 P regulation of inflammatory response
GO:0051291 P protein heterooligomerization
GO:0060544 P regulation of necroptotic process
GO:0060546 P negative regulation of necroptotic process
GO:0070424 P regulation of nucleotide-binding oligomerization domain containing signaling pathway
GO:0090307 P mitotic spindle assembly
GO:1990001 P inhibition of cysteine-type endopeptidase activity involved in apoptotic process
GO:2000116 P regulation of cysteine-type endopeptidase activity
RNA-seq EntryA_BomoMG_comp17739_c0_seq1
Sequence
(Amino Acid)
LSADRDAIMRAINFYIGIKNSENSNANYEQPTSIQPSAPIEDVDENNCTGVVNVVEESTL
ESECVICMDAKCEVVFIPCGHMCCCKDCGGGVEDCPMCRCSIERTIKVMMA
*(36 a.a.)

- SilkBase 1999-2023 -