SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG310_internal:A_BomoMG_comp17658_c0_seq1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		PREDICTED:_hemicentin-1_isoform_X6_[Papilio_xuthus]
Ontology
GO:0000165 P MAPK cascade
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007155 P cell adhesion
GO:0007254 P JNK cascade
GO:0007275 P multicellular organism development
GO:0007517 P muscle organ development
GO:0007519 P skeletal muscle tissue development
GO:0007520 P myoblast fusion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017022 F myosin binding
GO:0030838 P positive regulation of actin filament polymerization
GO:0032836 P glomerular basement membrane development
GO:0035418 P protein localization to synapse
GO:0036057 C slit diaphragm
GO:0042995 C cell projection
GO:0044062 P regulation of excretion
GO:0070062 C extracellular exosome
GO:0072015 P glomerular visceral epithelial cell development
RNA-seq EntryA_BomoMG_comp17658_c0_seq1
Sequence
(Amino Acid)
DFHTYIKPKAVELITGERKILVDGEVLGPLLERTKINISCIVREGKPQPKVVWYFNGKER
LDAQTQTPDNSTVIHTLSLTVTREEIGGKLQCTVSSAALDNPITKKISLNVKVPPNKTFI
YGDEEHATHGTLLTLMCTALGA
(46 a.a.)

- SilkBase 1999-2023 -