SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG28434_5prime_partial:A_BomoMG_comp171719_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_protein_toll-like_[Amyelois_transitella]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0002229 P defense response to oomycetes
GO:0002376 P immune system process
GO:0004888 F transmembrane signaling receptor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005769 C early endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006952 P defense response
GO:0006955 P immune response
GO:0006963 P positive regulation of antibacterial peptide biosynthetic process
GO:0006967 P positive regulation of antifungal peptide biosynthetic process
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007352 P zygotic specification of dorsal/ventral axis
GO:0007416 P synapse assembly
GO:0007507 P heart development
GO:0008063 P Toll signaling pathway
GO:0009617 P response to bacterium
GO:0009620 P response to fungus
GO:0009880 P embryonic pattern specification
GO:0009897 C external side of plasma membrane
GO:0009950 P dorsal/ventral axis specification
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016201 P synaptic target inhibition
GO:0019730 P antimicrobial humoral response
GO:0019732 P antifungal humoral response
GO:0019955 F cytokine binding
GO:0030097 P hemopoiesis
GO:0032154 C cleavage furrow
GO:0035007 P regulation of melanization defense response
GO:0035172 P hemocyte proliferation
GO:0042802 F identical protein binding
GO:0043234 C protein-containing complex
GO:0045087 P innate immune response
GO:0045610 P regulation of hemocyte differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050830 P defense response to Gram-positive bacterium
GO:0050832 P defense response to fungus
GO:0070976 F TIR domain binding
GO:1902875 P regulation of embryonic pattern specification
RNA-seq EntryA_BomoMG_comp171719_c0_seq1
Sequence
(Amino Acid)
GELLPARIAASLHDCRAALLFVSRSYMASPWCRLTFLLAQARAAHVSSFRVVVVLLEEPG
PEERELRAYLAARPPLKPADPLLWEKVLYKLRPRRASQKKLYRSLVKNGLQLQLDVEGKL
TNPAFVKDHD
*(42 a.a.)

- SilkBase 1999-2023 -