SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG28314_5prime_partial:A_BomoMG_comp160531_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
PREDICTED:_mediator_of_RNA_polymerase_II_transcription_subunit_13_[Bombyx_mori]
Ontology
GO:0001104 F transcription coregulator activity
GO:0004252 F serine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006508 P proteolysis
GO:0007275 P multicellular organism development
GO:0007526 P larval somatic muscle development
GO:0016592 C mediator complex
GO:0022416 P chaeta development
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0036011 P imaginal disc-derived leg segmentation
GO:0045165 P cell fate commitment
GO:0045498 P sex comb development
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:0048749 P compound eye development
GO:0070847 C core mediator complex
RNA-seq EntryA_BomoMG_comp160531_c0_seq1
Sequence
(Amino Acid)
PLAGMPAWWWASCAHLRDACPAFLKTALHLHSVHGADDYAAFTQRRDQPAHPLDSQTTTD
VLRYVLEGYNALSWLALDTSTHDRLSCLPLHVQVLMQLYHAAAALG
*(34 a.a.)

- SilkBase 1999-2023 -