SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG28252_complete:A_BomoMG_comp156273_c0_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
PREDICTED:_merlin,_partial_[Bombyx_mori]
Ontology
GO:0001707 P mesoderm formation
GO:0001726 C ruffle
GO:0001953 P negative regulation of cell-matrix adhesion
GO:0003779 F actin binding
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005769 C early endosome
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0006469 P negative regulation of protein kinase activity
GO:0007398 P ectoderm development
GO:0007420 P brain development
GO:0008013 F beta-catenin binding
GO:0008092 F cytoskeletal protein binding
GO:0008156 P negative regulation of DNA replication
GO:0008285 P negative regulation of cell population proliferation
GO:0014010 P Schwann cell proliferation
GO:0014013 P regulation of gliogenesis
GO:0016020 C membrane
GO:0019898 C extrinsic component of membrane
GO:0019904 F protein domain specific binding
GO:0021766 P hippocampus development
GO:0022408 P negative regulation of cell-cell adhesion
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0030175 C filopodium
GO:0030308 P negative regulation of cell growth
GO:0030336 P negative regulation of cell migration
GO:0030864 C cortical actin cytoskeleton
GO:0031527 C filopodium membrane
GO:0031647 P regulation of protein stability
GO:0032154 C cleavage furrow
GO:0032587 C ruffle membrane
GO:0035330 P regulation of hippo signaling
GO:0042127 P regulation of cell population proliferation
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042518 P negative regulation of tyrosine phosphorylation of STAT protein
GO:0042524 P negative regulation of tyrosine phosphorylation of STAT protein
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043234 C protein-containing complex
GO:0043409 P negative regulation of MAPK cascade
GO:0044297 C cell body
GO:0045121 C membrane raft
GO:0045177 C apical part of cell
GO:0045202 C synapse
GO:0045216 P cell-cell junction organization
GO:0045597 P positive regulation of cell differentiation
GO:0046426 P negative regulation of receptor signaling pathway via JAK-STAT
GO:0048471 C perinuclear region of cytoplasm
GO:0050767 P regulation of neurogenesis
GO:0051496 P positive regulation of stress fiber assembly
GO:0070306 P lens fiber cell differentiation
GO:0072091 P regulation of stem cell proliferation
GO:1900180 P regulation of protein localization to nucleus
GO:2000177 P regulation of neural precursor cell proliferation
RNA-seq EntryA_BomoMG_comp156273_c0_seq1
Sequence
(Amino Acid)
MPPFRRKKAAKSFPVKVCTLDAELEFNLEWRATGRDLFDLVCRTIGLRETWFFGLQFEDT
KHFISWLKLDKRVQDQCVSQMPGTPFMLLCKLYPEDVAEELIQEVTQHLLFLQVKQAILS
MDIYCPPEASVLLASYAVQAKYGDYDESAYKPGMLASEDLLPQRVIDQYQMTPEMWEDRI
KIWYADHKGMSRDEAEMEYLKIAQDLDMYGVNYFAIKNKKDTELYLGVTALGLNIYEKDN
KLTPKTTFPWSEIKHISFDDKKFIIKFVDRSVTNFIFFSPKGMNKLILDLCIGNHDLYMR
RRKPDTMEVQQMKAQAKEEKQRRQIERNKLSREKQLREVAERERAAMEQRLLQYQEEIRL
ANEALRRSEETAELLAEKGRVAEEEASLLAQKAADAERENARLRLSAIKTEEEKVHLERK
TREAEYLTARLVEESEKRAAEAERLKAELLTARVAEKQAKEKLLNFLSRTSTGSLPQQFP
ASPTVPCSLFPSTCSLPAELGGEGLQNGAAGAPEPELNSYQLVPDDSDPHIHRLSLEIEK
ERVEYLAKSKHLQAQLESLRGEFSVLRGEGRGEGRGTLDRQHAARPDDKYSTLRRLRQGS
TGQRLAFYEDL
*(203 a.a.)

- SilkBase 1999-2023 -