SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG28239_3prime_partial:A_BomoMG_comp155472_c0_seq1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
PREDICTED:_nuclear_receptor_coactivator_6-like_[Bombyx_mori]
Ontology
GO:0001541 P ovarian follicle development
GO:0002793 P positive regulation of peptide secretion
GO:0003682 F chromatin binding
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006351 P transcription, DNA-templated
GO:0006352 P DNA-templated transcription, initiation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006974 P cellular response to DNA damage stimulus
GO:0007420 P brain development
GO:0007507 P heart development
GO:0009725 P response to hormone
GO:0016922 F nuclear receptor binding
GO:0019899 F enzyme binding
GO:0019904 F protein domain specific binding
GO:0030099 P myeloid cell differentiation
GO:0030331 F estrogen receptor binding
GO:0030374 F nuclear receptor coactivator activity
GO:0030520 P intracellular estrogen receptor signaling pathway
GO:0035097 C histone methyltransferase complex
GO:0035257 F nuclear receptor binding
GO:0035259 F glucocorticoid receptor binding
GO:0035774 P positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042803 F protein homodimerization activity
GO:0042921 P glucocorticoid receptor signaling pathway
GO:0042974 F retinoic acid receptor binding
GO:0042975 F peroxisome proliferator activated receptor binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0044255 P cellular lipid metabolic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046965 F retinoid X receptor binding
GO:0046966 F thyroid hormone receptor binding
RNA-seq EntryA_BomoMG_comp155472_c0_seq1
Sequence
(Amino Acid)
MAADSDGPGSAGGGWCGVVVTCEGDLRDPRFPTRLRRLLRDLRTLLADPHPQHLKVNKVE
PWNSVRVTLSVPRAAAARLRALAMGGAPQLRALGILSVQLDGDAAVSLRLQHGAELTISA
DGDDASSSRSQSNVELLAGLEGIGRLMEGADGASTSADATPSSSTQNRDNFKSPNTVCPM
DGKIPQNIPTPTTDRCEFPFGSMTQARVIHRKENTLGLGGSSSSIRPSSDAMFARPSTSS
FTGPPPPYPAPPPPPP
(84 a.a.)

- SilkBase 1999-2023 -