SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG28129_complete:A_BomoMG_comp146489_c0_seq1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
PREDICTED:_mothers_against_decapentaplegic_homolog_3_[Papilio_polytes]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000983 F RNA polymerase II general transcription initiation factor activity
GO:0000987 F cis-regulatory region sequence-specific DNA binding
GO:0000988 F obsolete transcription factor activity, protein binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001501 P skeletal system development
GO:0001649 P osteoblast differentiation
GO:0001657 P ureteric bud development
GO:0001666 P response to hypoxia
GO:0001701 P in utero embryonic development
GO:0001707 P mesoderm formation
GO:0001756 P somitogenesis
GO:0001889 P liver development
GO:0001933 P negative regulation of protein phosphorylation
GO:0001947 P heart looping
GO:0002076 P osteoblast development
GO:0002520 P immune system development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005160 F transforming growth factor beta receptor binding
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005637 C nuclear inner membrane
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006810 P transport
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006955 P immune response
GO:0007050 P regulation of cell cycle
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007183 P SMAD protein complex assembly
GO:0007369 P gastrulation
GO:0007492 P endoderm development
GO:0008013 F beta-catenin binding
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0009880 P embryonic pattern specification
GO:0010628 P positive regulation of gene expression
GO:0010694 P positive regulation of alkaline phosphatase activity
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0016202 P regulation of striated muscle tissue development
GO:0017015 P regulation of transforming growth factor beta receptor signaling pathway
GO:0019049 P mitigation of host defenses by virus
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0019902 F phosphatase binding
GO:0023019 P signal transduction involved in regulation of gene expression
GO:0030308 P negative regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0030501 P positive regulation of bone mineralization
GO:0030618 F obsolete transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity
GO:0030878 P thyroid gland development
GO:0031490 F chromatin DNA binding
GO:0031625 F ubiquitin protein ligase binding
GO:0032332 P positive regulation of chondrocyte differentiation
GO:0032731 P positive regulation of interleukin-1 beta production
GO:0032909 P regulation of transforming growth factor beta2 production
GO:0032916 P positive regulation of transforming growth factor beta3 production
GO:0032924 P activin receptor signaling pathway
GO:0033689 P negative regulation of osteoblast proliferation
GO:0035413 P positive regulation of canonical Wnt signaling pathway
GO:0035556 P intracellular signal transduction
GO:0038092 P nodal signaling pathway
GO:0042110 P T cell activation
GO:0042177 P negative regulation of protein catabolic process
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0042993 P obsolete positive regulation of transcription factor import into nucleus
GO:0043066 P negative regulation of apoptotic process
GO:0043130 F ubiquitin binding
GO:0043234 C protein-containing complex
GO:0043235 C receptor complex
GO:0043425 F bHLH transcription factor binding
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045216 P cell-cell junction organization
GO:0045599 P negative regulation of fat cell differentiation
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045930 P negative regulation of mitotic cell cycle
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048340 P paraxial mesoderm morphogenesis
GO:0048589 P developmental growth
GO:0048617 P embryonic foregut morphogenesis
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0050678 P regulation of epithelial cell proliferation
GO:0050728 P negative regulation of inflammatory response
GO:0050776 P regulation of immune response
GO:0050821 P protein stabilization
GO:0050927 P positive regulation of positive chemotaxis
GO:0051098 P regulation of binding
GO:0051496 P positive regulation of stress fiber assembly
GO:0051894 P positive regulation of focal adhesion assembly
GO:0060039 P pericardium development
GO:0060290 P transdifferentiation
GO:0060395 P SMAD protein signal transduction
GO:0061045 P negative regulation of wound healing
GO:0070306 P lens fiber cell differentiation
GO:0070410 F co-SMAD binding
GO:0070412 F R-SMAD binding
GO:0071141 C SMAD protein complex
GO:0071144 C heteromeric SMAD protein complex
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:0097191 P extrinsic apoptotic signaling pathway
GO:0097296 P activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
GO:1901203 P positive regulation of extracellular matrix assembly
RNA-seq EntryA_BomoMG_comp146489_c0_seq1
Sequence
(Amino Acid)
MFPLTPPVVKRLLGWKKGPEGSSAAEDKWSEKAVKSLVKKLKKSGALEELERAISSQNSH
TKCVTIPRVKPNESGINGQYRKGLPHVVYCRLWRWPQLQSQHELKPVDHCEYAYQLKKDE
VCINPYHYNKIDSPALPPILVRRCSEGEVRAPPPYADYHQPILHEHPDVAMQSGTGHSAL
YLEATLAQHVPGNTTVHVSSSTVETPPPGYISEDGDPMDHNDNMNLTRLSPSPGGLASEA
SPVLYHEPAFWCSISYYELNTRVGETFHASQPSITVDGFTDPSNSERFCLGLLSNVNRNE
VVEQTRRHIGKGVRLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPGCNLK
IFNNQEFAALLSQSVSQGFEAVFQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLN
GPLQWLDRVLTQMGSPRLPCSSMS
*(147 a.a.)

- SilkBase 1999-2023 -