SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG27987_complete:A_BomoMG_comp125422_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		ras-related_protein_Rab7_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000331 C contractile vacuole
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005773 C vacuole
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0006886 P intracellular protein transport
GO:0006895 P Golgi to endosome transport
GO:0006913 P nucleocytoplasmic transport
GO:0006970 P response to osmotic stress
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0008152 P metabolic process
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0031164 C contractile vacuolar membrane
GO:0032456 P endocytic recycling
GO:0033298 P contractile vacuole organization
GO:0042742 P defense response to bacterium
GO:0044351 P macropinocytosis
GO:0045335 C phagocytic vesicle
GO:0048548 P regulation of pinocytosis
GO:0055037 C recycling endosome
GO:0090382 P phagosome maturation
GO:0090387 P phagolysosome assembly involved in apoptotic cell clearance
RNA-seq EntryA_BomoMG_comp125422_c0_seq1
Sequence
(Amino Acid)
MAVVKTPVLKVILCGEYGVGKSSLFRRFINNTFVPNSDRRATLGLDHFEKLYQVADKDVK
LQLWDTGGMERIASVTSSYYKFAEAAILVFSLDNASSFHILSQHLLEIVSYAENAKIFLC
GNKSDLEGASPQVTDADIETFCEQCHNLVNSTYKTSCKTGKGIEEMFADIALQLVEANRS
RIELQALDQNSFKISNPDQPQEPSCSC
*(68 a.a.)

- SilkBase 1999-2023 -