| Name | O_BomoMG27920_complete:A_BomoMG_comp115291_c0_seq1 |
| Scaffold_id | Bomo_Chr17 |
NCBI non-redundant
(nr) | PREDICTED:_globin_1_isoform_X1_[Bombyx_mori] |
| Ontology |
| GO:0001666 |
P |
response to hypoxia |
| GO:0004096 |
F |
catalase activity |
| GO:0004601 |
F |
peroxidase activity |
| GO:0005344 |
F |
oxygen carrier activity |
| GO:0005506 |
F |
iron ion binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0006810 |
P |
transport |
| GO:0006979 |
P |
response to oxidative stress |
| GO:0010764 |
P |
negative regulation of fibroblast migration |
| GO:0015671 |
P |
oxygen transport |
| GO:0019395 |
P |
fatty acid oxidation |
| GO:0019825 |
F |
oxygen binding |
| GO:0020037 |
F |
heme binding |
| GO:0032966 |
P |
negative regulation of collagen biosynthetic process |
| GO:0043005 |
C |
neuron projection |
| GO:0043025 |
C |
neuronal cell body |
| GO:0046872 |
F |
metal ion binding |
| GO:0047888 |
F |
fatty acid peroxidase activity |
| GO:0098869 |
P |
cellular oxidant detoxification |
| GO:2000490 |
P |
negative regulation of hepatic stellate cell activation |
|
| RNA-seq Entry | A_BomoMG_comp115291_c0_seq1 |
Sequence
(Amino Acid) | MGTWFSYMWWGGDPDVVNPVSGLTRREIHAVQKSWAPVNANSFATGSELLRRLFNTYPDT
KEYFKMVRKLPEEEYSQNPQFKAHVINLMTSLNLAVNNLNQPEIVAAMMTKLGESHRRRQ
IKEKNFHELKEVIVKLFIDVLRLDDATLSAWGKTVEFWYKHIFVTLNSPEETR
*(57 a.a.) |
