SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG278_3prime_partial:A_BomoMG_comp17591_c0_seq2
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		p53_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000733 P obsolete DNA strand renaturation
GO:0000785 C chromatin
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001046 F core promoter sequence-specific DNA binding
GO:0002039 F p53 binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005507 F copper ion binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005657 C replication fork
GO:0005667 C transcription regulator complex
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0006289 P nucleotide-excision repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006915 P apoptotic process
GO:0006978 P DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0007569 P cell aging
GO:0010165 P response to X-ray
GO:0010332 P response to gamma radiation
GO:0012501 P programmed cell death
GO:0030308 P negative regulation of cell growth
GO:0031065 P positive regulation of histone deacetylation
GO:0031571 P mitotic G1 DNA damage checkpoint signaling
GO:0034644 P cellular response to UV
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043153 P entrainment of circadian clock by photoperiod
GO:0043525 P positive regulation of neuron apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0048512 P circadian behavior
GO:0051262 P protein tetramerization
GO:0090200 P positive regulation of release of cytochrome c from mitochondria
GO:0097252 P oligodendrocyte apoptotic process
RNA-seq EntryA_BomoMG_comp17591_c0_seq2
Sequence
(Amino Acid)
MKHEIMTSLEVATCEDDIVNIDLNTIPDEALFQGGIHDQVDIGVLDDIPYIISDVSNNSN
NSFPLGPRGPPPRKDDPGQYNFSVEIHSKDTHKKKFLFSHKLNRIYVNMETDFAVQFNWE
LVDLAVTQMYVRATVVFEDESQAEKRVERCIQHKLCSSDKGQDRVVSENVLRSSRPLGTN
DVQYCGHPDDPDYWYSVLVQLPKPGREPCTHAFKFVCKNSCSTGINRRSIAVIFTLESAS
GSVLGRQTVGARVCSC
(84 a.a.)

- SilkBase 1999-2023 -