| Name | O_BomoMG27812_5prime_partial:A_BomoMG_comp102341_c0_seq1 |
| Scaffold_id | Bomo_Chr26 |
NCBI non-redundant
(nr) | PREDICTED:_macrophage_erythroblast_attacher_isoform_X2_[Bombyx_mori] |
| Ontology |
| GO:0003779 |
F |
actin binding |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005819 |
C |
spindle |
| GO:0005826 |
C |
actomyosin contractile ring |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005886 |
C |
plasma membrane |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0007010 |
P |
cytoskeleton organization |
| GO:0007049 |
P |
cell cycle |
| GO:0007155 |
P |
cell adhesion |
| GO:0015629 |
C |
actin cytoskeleton |
| GO:0016020 |
C |
membrane |
| GO:0016363 |
C |
nuclear matrix |
| GO:0033033 |
P |
negative regulation of myeloid cell apoptotic process |
| GO:0043249 |
P |
erythrocyte maturation |
| GO:0048821 |
P |
erythrocyte development |
| GO:0048822 |
P |
enucleate erythrocyte development |
| GO:0051301 |
P |
cell division |
|
| RNA-seq Entry | A_BomoMG_comp102341_c0_seq1 |
Sequence
(Amino Acid) | LQLGLAALNTPQCYKESSQAADCPACQAPLSGLARQLPHAHCSHSRLVCRISRLPLNEHN
QPMVLPNGQVYGEKALKQMMKEHGSIICPKTKEVFCMKRVEKVYVM
*(34 a.a.) |
