SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG27783_internal:A_BomoMG_comp97688_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
Ontology
GO:0000976 F transcription cis-regulatory region binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0002809 P negative regulation of antibacterial peptide biosynthetic process
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007389 P pattern specification process
GO:0007400 P neuroblast fate determination
GO:0007402 P ganglion mother cell fate determination
GO:0007419 P ventral cord development
GO:0035220 P wing disc development
GO:0036022 P limb joint morphogenesis
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048813 P dendrite morphogenesis
RNA-seq EntryA_BomoMG_comp97688_c0_seq1
Sequence
(Amino Acid)
GAGLGAGLAEAVGRRRKKRTSIESGVRVALEKAFLHNPKPTSEEIAALADSLCMEKEVVR
VWFCNRRQKEKRINPPTGEGGAGLLPALAHAHSHALHAHAHAQ
(33 a.a.)

- SilkBase 1999-2023 -