SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG276_3prime_partial:A_BomoMG_comp17591_c0_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		p53_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000785 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006915 P apoptotic process
GO:0006954 P inflammatory response
GO:0006974 P cellular response to DNA damage stimulus
GO:0006978 P DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007346 P regulation of mitotic cell cycle
GO:0008134 F transcription factor binding
GO:0008285 P negative regulation of cell population proliferation
GO:0009791 P post-embryonic development
GO:0010165 P response to X-ray
GO:0010332 P response to gamma radiation
GO:0010468 P regulation of gene expression
GO:0019901 F protein kinase binding
GO:0021766 P hippocampus development
GO:0030054 C cell junction
GO:0030900 P forebrain development
GO:0031571 P mitotic G1 DNA damage checkpoint signaling
GO:0033326 P cerebrospinal fluid secretion
GO:0034644 P cellular response to UV
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042802 F identical protein binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043523 P regulation of neuron apoptotic process
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045793 P positive regulation of cell size
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048546 P digestive tract morphogenesis
GO:0048666 P neuron development
GO:0051262 P protein tetramerization
GO:0060044 P negative regulation of cardiac muscle cell proliferation
GO:0071158 P regulation of cell cycle
GO:1902167 P positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:2001235 P positive regulation of apoptotic signaling pathway
RNA-seq EntryA_BomoMG_comp17591_c0_seq1
Sequence
(Amino Acid)
MVIFQLGPRGPPPRKDDPGQYNFSVEIHSKDTHKKKFLFSHKLNRIYVNMETDFAVQFNW
ELVDLAVTQMYVRATVVFEDESQAEKRVERCIQHKLCSSDKGQDRVVSENVLRSSRPLGT
NDVQYCGHPDDPDYWYSVLVQLPKPGREPCTHAFKFVCKNSCSTGINRRSIAVIFTLESA
SGSVLGRQTVGARVCSC
(64 a.a.)

- SilkBase 1999-2023 -