SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG27670_internal:A_BomoMG_comp75639_c0_seq1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000165 P MAPK cascade
GO:0003779 F actin binding
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005200 F structural constituent of cytoskeleton
GO:0005543 F phospholipid binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007411 P axon guidance
GO:0007416 P synapse assembly
GO:0008021 C synaptic vesicle
GO:0008091 C spectrin
GO:0016192 P vesicle-mediated transport
GO:0016324 C apical plasma membrane
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0021692 P cerebellar Purkinje cell layer morphogenesis
GO:0030054 C cell junction
GO:0030534 P adult behavior
GO:0035264 P multicellular organism growth
GO:0043025 C neuronal cell body
GO:0043547 P positive regulation of GTPase activity
GO:0048471 C perinuclear region of cytoplasm
GO:0051693 P actin filament capping
GO:0071361 P cellular response to ethanol
RNA-seq EntryA_BomoMG_comp75639_c0_seq1
Sequence
(Amino Acid)
RPAPRDLRAATALLRDHDTLRNDLLAVDAQMQVLQEEGSRLQKLYPGGNVTQIALQQKAL
AEAWEMLKQAADERKHVLLQHLQLHQFLTQVRDLTSWCRSVAASLGGGVRVRDAVS
(37 a.a.)

- SilkBase 1999-2023 -