SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG2732_5prime_partial:A_BomoMG_comp22271_c0_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		PREDICTED:_cytoplasmic_polyadenylation_element-binding_protein_1_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0000900 F translation repressor activity, mRNA regulatory element binding
GO:0000922 C spindle pole
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006397 P mRNA processing
GO:0006417 P regulation of translation
GO:0016020 C membrane
GO:0030529 C ribonucleoprotein complex
GO:0032869 P cellular response to insulin stimulus
GO:0035925 F mRNA 3'-UTR AU-rich region binding
GO:0043234 C protein-containing complex
GO:0046872 F metal ion binding
GO:0071230 P cellular response to amino acid stimulus
GO:0071456 P cellular response to hypoxia
GO:2000766 P negative regulation of cytoplasmic translation
RNA-seq EntryA_BomoMG_comp22271_c0_seq1
Sequence
(Amino Acid)
IYHNLFSLNKYYIICVKVQVDPYLEDSMCSVCNLQQGPYFCREPTCFGYFCRSCWSWQHS
TEQHKPLMRSSKNNNRQSPPSDNAPAYNSASSNGTPSPSTSGTSEHEHSENVWPPH
*(38 a.a.)

- SilkBase 1999-2023 -