SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG2655_3prime_partial:A_BomoMG_comp22138_c0_seq1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_cyclin-T1_[Papilio_polytes]
Ontology
GO:0000307 C cyclin-dependent protein kinase holoenzyme complex
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0008024 C cyclin/CDK positive transcription elongation factor complex
GO:0016032 P viral process
GO:0016538 F cyclin-dependent protein serine/threonine kinase regulator activity
GO:0017069 F snRNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045737 P positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051301 P cell division
GO:0097322 F 7SK snRNA binding
GO:1900364 P negative regulation of mRNA polyadenylation
GO:1901409 P positive regulation of phosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_BomoMG_comp22138_c0_seq1
Sequence
(Amino Acid)
MAGGQEKWYFTKEQLQNSPSRKCGLDADKELAYRQQAANLIQDMGQRLQVSQLCINTAIV
YMHRFYAFHSFTQFHRNAIAAAALFLAAKVEEQPRKLEYVIKVAHVCLHRGEGVNALTPE
QYQEQAQDLVFNENVLLQTLGFDVAIDHPHTHVVRTCHLVKATKDLAQTSYFMAS
(57 a.a.)

- SilkBase 1999-2023 -