SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG263_internal:A_BomoMG_comp17579_c0_seq1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
PREDICTED:_kinesin-like_protein_unc-104_isoform_X4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003674 F molecular_function
GO:0003777 F microtubule motor activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0007018 P microtubule-based movement
GO:0007411 P axon guidance
GO:0007528 P neuromuscular junction development
GO:0008017 F microtubule binding
GO:0008088 P axo-dendritic transport
GO:0008089 P anterograde axonal transport
GO:0008152 P metabolic process
GO:0008345 P larval locomotory behavior
GO:0016188 P synaptic vesicle maturation
GO:0016192 P vesicle-mediated transport
GO:0016887 F ATP hydrolysis activity
GO:0030424 C axon
GO:0030425 C dendrite
GO:0032024 P positive regulation of insulin secretion
GO:0040012 P regulation of locomotion
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0046847 P filopodium assembly
GO:0047496 P vesicle transport along microtubule
GO:0048489 P synaptic vesicle transport
GO:0048490 P anterograde synaptic vesicle transport
GO:0048814 P regulation of dendrite morphogenesis
GO:0051963 P regulation of synapse assembly
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomoMG_comp17579_c0_seq1
Sequence
(Amino Acid)
DEDGALSLGLFPGERPALDDRAVFRFEAAWDSSLHGSPLLNRVSANGEVVYITLSAYLEM
ENCGRPAIVTKDLSVVVVGREARTGRSLRRALFGSRAARADHITGVYELSLHRALEPGVQ
RRQRR
(40 a.a.)

- SilkBase 1999-2023 -