SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG2493_complete:A_BomoMG_comp21886_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		basic_helix-loop-helix_type_transcription_factor_HLH54F_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001657 P ureteric bud development
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001763 P morphogenesis of a branching structure
GO:0001822 P kidney development
GO:0001944 P vasculature development
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007530 P sex determination
GO:0007548 P sex differentiation
GO:0009887 P animal organ morphogenesis
GO:0014707 P branchiomeric skeletal muscle development
GO:0030855 P epithelial cell differentiation
GO:0031063 P regulation of histone deacetylation
GO:0032835 P glomerulus development
GO:0042826 F histone deacetylase binding
GO:0043425 F bHLH transcription factor binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046983 F protein dimerization activity
GO:0048286 P lung alveolus development
GO:0048536 P spleen development
GO:0048557 P embryonic digestive tract morphogenesis
GO:0048608 P reproductive structure development
GO:0048732 P gland development
GO:0050681 F androgen receptor binding
GO:0060008 P Sertoli cell differentiation
GO:0060021 P roof of mouth development
GO:0060425 P lung morphogenesis
GO:0060426 P lung vasculature development
GO:0060435 P bronchiole development
GO:0060539 P diaphragm development
GO:0060541 P respiratory system development
GO:0060766 P negative regulation of androgen receptor signaling pathway
GO:0070888 F E-box binding
GO:0072162 P metanephric mesenchymal cell differentiation
GO:0072277 P metanephric glomerular capillary formation
RNA-seq EntryA_BomoMG_comp21886_c0_seq1
Sequence
(Amino Acid)
MPRKRTNKSPSVDKRSEPDIDDDDFYFDDTQSNSGRNSHEPHRNAANARERARMRVLSKA
FCRLKTTLPWVPADTKLSKLDTLRLAASYIAHLRALLHEPRSAHTPPHPLSLAWPFAFQH
GGSLNCAVSQRWNVGAPEPSCRSNITPREAMQSQDNYNEYDNDYEERCYEDVSSNDACAQ
MQYCDYGYKEDYYEIRNSYPTDNAINNI
*(68 a.a.)

- SilkBase 1999-2023 -