SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG241_3prime_partial:A_BomoMG_comp17539_c0_seq1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC105390905_[Plutella_xylostella]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003334 P keratinocyte development
GO:0003382 P epithelial cell morphogenesis
GO:0003676 F nucleic acid binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007165 P signal transduction
GO:0007409 P axonogenesis
GO:0008285 P negative regulation of cell population proliferation
GO:0009791 P post-embryonic development
GO:0010468 P regulation of gene expression
GO:0010837 P regulation of keratinocyte proliferation
GO:0019216 P regulation of lipid metabolic process
GO:0021773 P striatal medium spiny neuron differentiation
GO:0021902 P commitment of neuronal cell to specific neuron type in forebrain
GO:0021953 P central nervous system neuron differentiation
GO:0022008 P neurogenesis
GO:0031077 P post-embryonic camera-type eye development
GO:0033077 P T cell differentiation in thymus
GO:0033153 P T cell receptor V(D)J recombination
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0043005 C neuron projection
GO:0043066 P negative regulation of apoptotic process
GO:0043368 P positive T cell selection
GO:0043565 F sequence-specific DNA binding
GO:0043588 P skin development
GO:0044212 F transcription cis-regulatory region binding
GO:0045664 P regulation of neuron differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046632 P alpha-beta T cell differentiation
GO:0046872 F metal ion binding
GO:0048538 P thymus development
GO:0071678 P olfactory bulb axon guidance
RNA-seq EntryA_BomoMG_comp17539_c0_seq1
Sequence
(Amino Acid)
MRIKMPAVRIAQADADSAAEGGGSPTPGVPADTLTCGACRRAFALADIIRFIQHKVSSCD
KELTSYHCYSAGPNSDQEDGSRPGQVSTANSSGRRPSLLTARRLP
(34 a.a.)

- SilkBase 1999-2023 -