SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG230_internal:A_BomoMG_comp17527_c0_seq1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		nuclear_orphan_receptor_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0003713 F transcription coactivator activity
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0007283 P spermatogenesis
GO:0007399 P nervous system development
GO:0008270 F zinc ion binding
GO:0021549 P cerebellum development
GO:0030154 P cell differentiation
GO:0038066 P p38MAPK cascade
GO:0040019 P positive regulation of embryonic development
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0045663 P positive regulation of myoblast differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048520 P positive regulation of behavior
GO:0051321 P meiotic cell cycle
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
RNA-seq EntryA_BomoMG_comp17527_c0_seq1
Sequence
(Amino Acid)
AALPAATALPFEIQVTLFKKSWAELFVLGLCKLSHEMSLGTLLPSMAGHLHAVLRERASG
AAAAHAPLDDHAPEISVWDYTDERIAEIISLLSRLQQLVAAMEQLRVTDREYAQLRALCF
FSPDGAPACAAARLEEA
(44 a.a.)

- SilkBase 1999-2023 -