SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG22939_internal:A_BomoMG_comp40953_c0_seq25
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
Ontology
GO:0001933 P negative regulation of protein phosphorylation
GO:0003779 F actin binding
GO:0004497 F monooxygenase activity
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0008270 F zinc ion binding
GO:0016491 F oxidoreductase activity
GO:0016709 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0017124 F SH3 domain binding
GO:0017137 F small GTPase binding
GO:0019417 P sulfur oxidation
GO:0030042 P actin filament depolymerization
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0046872 F metal ion binding
GO:0055114 P obsolete oxidation-reduction process
GO:0071949 F FAD binding
RNA-seq EntryA_BomoMG_comp40953_c0_seq25
Sequence
(Amino Acid)
ADGLHLHRACFRCAVCKTVLRPGNYKMERYGNRLVCLRHSGVSVTDAVAAASALDAPQPT
RSQAPTPTPERISIELSDSGAREIDEDEWTDRNFLASETSGAGGLSDEEESSSEDYTDAD
EGDNEADHSPEPQGIAEVRSPRA
(46 a.a.)

- SilkBase 1999-2023 -