SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG22659_3prime_partial:A_BomoMG_comp40930_c0_seq4
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
Ontology
GO:0001666 P response to hypoxia
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0003726 F double-stranded RNA adenosine deaminase activity
GO:0004000 F adenosine deaminase activity
GO:0005622 C intracellular anatomical structure
GO:0006382 P adenosine to inosine editing
GO:0006396 P RNA processing
GO:0006397 P mRNA processing
GO:0006979 P response to oxidative stress
GO:0007626 P locomotory behavior
GO:0008049 P male courtship behavior
GO:0008344 P adult locomotory behavior
GO:0009408 P response to heat
GO:0009451 P RNA modification
GO:0010906 P regulation of glucose metabolic process
GO:0016556 P mRNA modification
GO:0016787 F hydrolase activity
GO:0030534 P adult behavior
GO:0042391 P regulation of membrane potential
GO:0042752 P regulation of circadian rhythm
GO:0045475 P locomotor rhythm
GO:0046872 F metal ion binding
GO:0060964 P regulation of gene silencing by miRNA
RNA-seq EntryA_BomoMG_comp40930_c0_seq4
Sequence
(Amino Acid)
MQGERLLTMSCSDKVARWCVLGLQGSLMSTLLAPVYPTSIVLGSLLHPHHLYRAICGRIE
AYISSLPPPYHLRRPLLARAASTEARTPTRAPSFSVCWACTNTAPEVLNATTGKLENG
(38 a.a.)

- SilkBase 1999-2023 -