SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG223_internal:A_BomoMG_comp17494_c1_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
para_sodium_channel_alpha_subunit_[Bombyx_mori]
Ontology
GO:0001518 C voltage-gated sodium channel complex
GO:0001666 P response to hypoxia
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005248 F voltage-gated sodium channel activity
GO:0005272 F sodium channel activity
GO:0005509 F calcium ion binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006814 P sodium ion transport
GO:0007268 P chemical synaptic transmission
GO:0007638 P mechanosensory behavior
GO:0009612 P response to mechanical stimulus
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019228 P neuronal action potential
GO:0034220 P ion transmembrane transport
GO:0034765 P regulation of ion transmembrane transport
GO:0035725 P sodium ion transmembrane transport
GO:0042493 P response to xenobiotic stimulus
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0046680 P response to DDT
GO:0046684 P response to pyrethroid
GO:0055085 P transmembrane transport
GO:0060078 P regulation of postsynaptic membrane potential
GO:0086010 P membrane depolarization during action potential
RNA-seq EntryA_BomoMG_comp17494_c1_seq1
Sequence
(Amino Acid)
GKVLKPSSDNPFIESSQQPNVVDMRDVMVLNEIIEQAGRQSRASEQNVSVYYFPTAEDDE
DGPTFKEKLLDCLMKGIDFFCVWDCCWLWLEFQKYVALLVFDPFVELFITLCIVVNTLFM
ALDHHNMDKDMDKALKSGNYFFTATFGIEATLKLIAMSPKYYFQEGWNIFDFIIVALSLL
ELGLEGVQGLSVLR
(63 a.a.)

- SilkBase 1999-2023 -