SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG221_internal:A_BomoMG_comp17484_c0_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		PREDICTED:_LIM_domain_kinase_1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001736 P establishment of planar polarity
GO:0001737 P establishment of imaginal disc-derived wing hair orientation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0007416 P synapse assembly
GO:0007560 P imaginal disc morphogenesis
GO:0008270 F zinc ion binding
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030036 P actin cytoskeleton organization
GO:0030496 C midbody
GO:0032154 C cleavage furrow
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
GO:0048812 P neuron projection morphogenesis
GO:0050770 P regulation of axonogenesis
GO:0051124 P synaptic assembly at neuromuscular junction
RNA-seq EntryA_BomoMG_comp17484_c0_seq1
Sequence
(Amino Acid)
NVYDEKVDVFSFGIILCEIIGRVSADPDCLPRRSDFGLNEEVFLEKFCASCPEPFYRIAF
LACNLDPDDRPPMEVIETWLEALVEQLSESELKENLDVLCNDLDSPTEGSLVKSDS
(37 a.a.)

- SilkBase 1999-2023 -