SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG209_5prime_partial:A_BomoMG_comp17462_c1_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		PREDICTED:_zinc_finger_protein_236-like_[Amyelois_transitella]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007283 P spermatogenesis
GO:0008584 P male gonad development
GO:0010468 P regulation of gene expression
GO:0030217 P T cell differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoMG_comp17462_c1_seq1
Sequence
(Amino Acid)
REAETITPPHIRQEELREQSDSQQKPVKELGTMCSIAGCQIRLRDENNLSYHRKSHQSGK
LICQECMKTFLNVDSLHSHLWKVHTIDLELPTCEICGFKTYKKHSSM
*(35 a.a.)

- SilkBase 1999-2023 -