SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG2075_5prime_partial:A_BomoMG_comp21250_c0_seq1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
PREDICTED:_polyribonucleotide_nucleotidyltransferase_1,_mitochondrial_[Amyelois_transitella]
Ontology
GO:0000175 F 3'-5'-exoribonuclease activity
GO:0000957 P mitochondrial RNA catabolic process
GO:0000958 P mitochondrial mRNA catabolic process
GO:0000962 P positive regulation of mitochondrial RNA catabolic process
GO:0000964 P mitochondrial RNA 5'-end processing
GO:0000965 P mitochondrial RNA 3'-end processing
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0004518 F nuclease activity
GO:0004527 F exonuclease activity
GO:0004654 F polyribonucleotide nucleotidyltransferase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005758 C mitochondrial intermembrane space
GO:0006396 P RNA processing
GO:0006397 P mRNA processing
GO:0006401 P RNA catabolic process
GO:0006402 P mRNA catabolic process
GO:0006810 P transport
GO:0008266 F poly(U) RNA binding
GO:0016020 C membrane
GO:0016740 F transferase activity
GO:0016779 F nucleotidyltransferase activity
GO:0016787 F hydrolase activity
GO:0034046 F poly(G) binding
GO:0034599 P cellular response to oxidative stress
GO:0035198 F miRNA binding
GO:0035458 P cellular response to interferon-beta
GO:0035927 P RNA import into mitochondrion
GO:0035928 P rRNA import into mitochondrion
GO:0043457 P regulation of cellular respiration
GO:0043631 P RNA polyadenylation
GO:0044822 F RNA binding
GO:0045025 C mitochondrial degradosome
GO:0045926 P negative regulation of growth
GO:0051260 P protein homooligomerization
GO:0061014 P positive regulation of mRNA catabolic process
GO:0070207 P protein homotrimerization
GO:0070584 P mitochondrion morphogenesis
GO:0071042 P nuclear polyadenylation-dependent mRNA catabolic process
GO:0071850 P regulation of cell cycle
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
GO:0097222 P mitochondrial mRNA polyadenylation
GO:2000627 P positive regulation of miRNA catabolic process
GO:2000772 P regulation of cellular senescence
RNA-seq EntryA_BomoMG_comp21250_c0_seq1
Sequence
(Amino Acid)
PQLPYTVRLTAEVLESNGSSSMASVCGGSLALMDAGVPLGGPAAGVAVGLVSKADENGHM
ADYRILTDLLGIEDYMGDMDFKVAGTKKGITALQADIKLAGLPLRVVMEAVQRACDAKAK
IIDIMNQCLDAPRQGLKENMPVIEEIEVEAHKRPKLHGLGGSNLKKLYVETGVQVTPVDE
TKYSVFAPSRPAMDEARSRMASWLTSERTPELEFGAIYKARVVEVRDIGVLVTLYPGMSP
ALVHNTQLDHRKIMHPSVLGLEVGSEIQVKYFGRDPVSGQVRLSKKVLSSPPPAVVRNLD
KS
*(100 a.a.)

- SilkBase 1999-2023 -