SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG20191_5prime_partial:A_BomoMG_comp40688_c0_seq1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
Ontology
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003707 F steroid hormone receptor activity
GO:0004879 F nuclear receptor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006629 P lipid metabolic process
GO:0007492 P endoderm development
GO:0007498 P mesoderm development
GO:0008270 F zinc ion binding
GO:0008610 P lipid biosynthetic process
GO:0010906 P regulation of glucose metabolic process
GO:0016042 P lipid catabolic process
GO:0030522 P intracellular receptor signaling pathway
GO:0034440 P lipid oxidation
GO:0043401 P steroid hormone mediated signaling pathway
GO:0043565 F sequence-specific DNA binding
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoMG_comp40688_c0_seq1
Sequence
(Amino Acid)
LPPLQSIISDRQYDGRGRFGELLLCLPPLQSITWQMIEQIQFAKLFGVAHVDSLLQEMLL
GGATTEAVLEEPSPEPAAASPSPPLVPLVPLVPQLPQLPGNDSAFLEPMPFKQEPNI
*(38 a.a.)

- SilkBase 1999-2023 -