SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG20187_5prime_partial:A_BomoMG_comp40687_c0_seq2
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
Ontology
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005543 F phospholipid binding
GO:0005544 F calcium-dependent phospholipid binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005813 C centrosome
GO:0005886 C plasma membrane
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0006906 P vesicle fusion
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0017137 F small GTPase binding
GO:0017158 P regulation of calcium ion-dependent exocytosis
GO:0019898 C extrinsic component of membrane
GO:0019905 F syntaxin binding
GO:0030141 C secretory granule
GO:0030276 F clathrin binding
GO:0030658 C transport vesicle membrane
GO:0030667 C secretory granule membrane
GO:0031410 C cytoplasmic vesicle
GO:0042043 F neurexin family protein binding
GO:0045921 P positive regulation of exocytosis
GO:0046676 P negative regulation of insulin secretion
GO:0046872 F metal ion binding
GO:0048791 P calcium ion-regulated exocytosis of neurotransmitter
GO:0050714 P positive regulation of protein secretion
GO:0070382 C exocytic vesicle
GO:0071985 P multivesicular body sorting pathway
GO:0098793 C presynapse
RNA-seq EntryA_BomoMG_comp40687_c0_seq2
Sequence
(Amino Acid)
QTLASLSSRTLWLSVWHADMFGRNDFLGEVSLPLADVVFDDPAPTWYKLHERTEHFDEQQ
GTRGDLIVGLKFELHETGAMRGKGTLHVLVKEAKNLVATKPNGLADVFCKSYLLPERGRL
AKQKTSVARRTLSPRWEHTFTYRGLKPQDLAARALELSLWDRDRLASNDFMGAVRLSLGT
GTYMGANVNWMDSAGKEVSLWQTMMERPNFWVEGSLPLRPQLIN
*(74 a.a.)

- SilkBase 1999-2023 -