SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG2013_internal:A_BomoMG_comp21172_c1_seq1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		Eph_receptor_[Danaus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0003404 P optic vesicle morphogenesis
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005524 F ATP binding
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0009952 P anterior/posterior pattern specification
GO:0009988 P cell-cell recognition
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0021654 P rhombomere boundary formation
GO:0030517 P negative regulation of axon extension
GO:0030900 P forebrain development
GO:0048685 P negative regulation of collateral sprouting of intact axon in response to injury
RNA-seq EntryA_BomoMG_comp21172_c1_seq1
Sequence
(Amino Acid)
VIFLQGVVTKCNPIMIITEFMENGSLDTFLRANDGKFRVLQLVGMLRGIATGMQYLSEMN
YIHRDLAARNVLVNSQLVCKIADFGLSREIESTADGAYTTRGGKIPVRWTAPEAIAFRKF
TSASDVWSMGIVCWEVMSFGERPYWNWSNQDVIKSIEK
(51 a.a.)

- SilkBase 1999-2023 -