SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG2012_5prime_partial:A_BomoMG_comp21172_c0_seq1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
Eph_receptor_[Danaus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005003 F ephrin receptor activity
GO:0005004 F GPI-linked ephrin receptor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007420 P brain development
GO:0008046 F axon guidance receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0022407 P regulation of cell-cell adhesion
GO:0030425 C dendrite
GO:0031290 P retinal ganglion cell axon guidance
GO:0031594 C neuromuscular junction
GO:0031952 P regulation of protein autophosphorylation
GO:0043025 C neuronal cell body
GO:0043065 P positive regulation of apoptotic process
GO:0043281 P regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043525 P positive regulation of neuron apoptotic process
GO:0045211 C postsynaptic membrane
GO:0045499 F chemorepellent activity
GO:0046875 F ephrin receptor binding
GO:0048013 P ephrin receptor signaling pathway
GO:0048671 P negative regulation of collateral sprouting
GO:0048755 P branching morphogenesis of a nerve
GO:0050730 P regulation of peptidyl-tyrosine phosphorylation
GO:0050919 P negative chemotaxis
GO:0051964 P negative regulation of synapse assembly
GO:0070372 P regulation of ERK1 and ERK2 cascade
GO:0072178 P nephric duct morphogenesis
RNA-seq EntryA_BomoMG_comp21172_c0_seq1
Sequence
(Amino Acid)
QLKKGYRLPAPMDCPEAVYQLMLDCWQKERTHRPTFSSIVKTLDKLIRCPDTLRKIAQNR
SADPLAGDTPDLIQFTSVEEWLECIKMSRYIEKFRAAGISDMDAVVDLTVHQLASLGVTL
VGHQKKIMNSVQSMRAQIRGSGPYGFLV
*(48 a.a.)

- SilkBase 1999-2023 -