SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG20058_complete:A_BomoMG_comp40675_c0_seq4
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0000145 C exocyst
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006893 P Golgi to plasma membrane transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007409 P axonogenesis
GO:0008152 P metabolic process
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0016197 P endosomal transport
GO:0019003 F GDP binding
GO:0030659 C cytoplasmic vesicle membrane
GO:0030670 C phagocytic vesicle membrane
GO:0030859 P polarized epithelial cell differentiation
GO:0031410 C cytoplasmic vesicle
GO:0032593 C insulin-responsive compartment
GO:0032869 P cellular response to insulin stimulus
GO:0042995 C cell projection
GO:0043001 P Golgi to plasma membrane protein transport
GO:0045200 P establishment of neuroblast polarity
GO:0055037 C recycling endosome
GO:0055038 C recycling endosome membrane
GO:0061467 P protein localization to basolateral plasma membrane
GO:0071782 C endoplasmic reticulum tubular network
GO:0071786 P endoplasmic reticulum tubular network organization
GO:0072372 C cilium
GO:0072659 P protein localization to plasma membrane
GO:0097051 P establishment of protein localization to endoplasmic reticulum membrane
RNA-seq EntryA_BomoMG_comp40675_c0_seq4
Sequence
(Amino Acid)
MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDNHFTTTFISTIGIDFKIKTVELRGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKTFDDIVKWLRNIDEHANEDVEKMIL
GNKCDMEEKRVVSKERGEAIAREHGIRFMETSAKANINIDRAFSELAEAILDKTAGREAD
ADHSRIAVERRPSRAPPSRACCT
*(67 a.a.)

- SilkBase 1999-2023 -