SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG19885_5prime_partial:A_BomoMG_comp40659_c0_seq3
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
Ontology
GO:0000288 P nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0001570 P vasculogenesis
GO:0003342 P proepicardium development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006355 P regulation of transcription, DNA-templated
GO:0006402 P mRNA catabolic process
GO:0006417 P regulation of translation
GO:0006915 P apoptotic process
GO:0007507 P heart development
GO:0008283 P cell population proliferation
GO:0017091 F mRNA 3'-UTR AU-rich region binding
GO:0021915 P neural tube development
GO:0033077 P T cell differentiation in thymus
GO:0035264 P multicellular organism growth
GO:0043488 P regulation of mRNA stability
GO:0044822 F RNA binding
GO:0046872 F metal ion binding
GO:0048568 P embryonic organ development
GO:0060710 P chorio-allantoic fusion
GO:0060712 P spongiotrophoblast layer development
RNA-seq EntryA_BomoMG_comp40659_c0_seq3
Sequence
(Amino Acid)
ATSRYKTELCRPFEEAGVCKYGDKCQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYG
PRCHFVHNAEEARRREPSSPGGSLASLSSGGSMASYMSDGSRSPRSPHSPLTPHSPPAMS
PPAQATAFAFRRTNSPDPEDDRLPVFNRLSSALGDLVIA
*(52 a.a.)

- SilkBase 1999-2023 -