SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG19851_3prime_partial:A_BomoMG_comp40656_c0_seq5
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007062 P sister chromatid cohesion
GO:0007064 P mitotic sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007126 P meiotic cell cycle
GO:0008280 C cohesin complex
GO:0009314 P response to radiation
GO:0019827 P stem cell population maintenance
GO:0030893 C meiotic cohesin complex
GO:0032876 P negative regulation of DNA endoreduplication
GO:0036033 F mediator complex binding
GO:0042770 P signal transduction in response to DNA damage
GO:0044822 F RNA binding
GO:0046982 F protein heterodimerization activity
GO:0051276 P chromosome organization
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
RNA-seq EntryA_BomoMG_comp40656_c0_seq5
Sequence
(Amino Acid)
MEASRQAARYLQELDSVNREQKADQDRLDNELRKKGELENKHRQKGHERNEAVKRVDKLN
EHIKSSEQALEEQRRLRAELQADVGSCRGRAASLQTQLEDVAAQLGDARVDKHEEARRRK
KQEIVESFKRDIPGVYDRMINMCQPTHKRYNVAITKVLGKYMEAIVVDTEKTARRCIQVL
KERMLEPETFLPLDYIQAKPLRGHHLQCP
(68 a.a.)

- SilkBase 1999-2023 -