SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG19788_complete:A_BomoMG_comp40649_c1_seq23
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
Ontology
GO:0003333 P amino acid transmembrane transport
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006461 P protein-containing complex assembly
GO:0006810 P transport
GO:0006865 P amino acid transport
GO:0015171 F amino acid transmembrane transporter activity
GO:0015175 F neutral amino acid transmembrane transporter activity
GO:0015184 F L-cystine transmembrane transporter activity
GO:0015297 F antiporter activity
GO:0015804 P neutral amino acid transport
GO:0015811 P L-cystine transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0031526 C brush border membrane
GO:0042605 F peptide antigen binding
GO:0050900 P leukocyte migration
RNA-seq EntryA_BomoMG_comp40649_c1_seq23
Sequence
(Amino Acid)
MSVSEMADSEAVAVTFGNRLLGPMAWLMPLAVTISTFGSANGTLFVAGRLCFAASREGHL
LDILSYVHVRRFTPAPGLIFHVSYKPRVESFYCQKKSRSKKI
*(33 a.a.)

- SilkBase 1999-2023 -