SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG19528_5prime_partial:A_BomoMG_comp40628_c0_seq5
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0000790 C chromatin
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006723 P cuticle hydrocarbon biosynthetic process
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0007517 P muscle organ development
GO:0008168 F methyltransferase activity
GO:0016458 P obsolete gene silencing
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0022008 P neurogenesis
GO:0032259 P methylation
GO:0035097 C histone methyltransferase complex
GO:0035098 C ESC/E(Z) complex
GO:0035186 P syncytial blastoderm mitotic cell cycle
GO:0042054 F histone methyltransferase activity
GO:0042810 P pheromone metabolic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0046976 F histone methyltransferase activity (H3-K27 specific)
GO:0048813 P dendrite morphogenesis
GO:0051567 P histone H3-K9 methylation
GO:0070734 P histone H3-K27 methylation
RNA-seq EntryA_BomoMG_comp40628_c0_seq5
Sequence
(Amino Acid)
KHVVARRYNYTPCDHPSQPCDSLCPCLQSQNFCEKFCQCSSDCQNRFPGCRCKAQCNTKQ
CPCYLGVRECDPDLCTACGADASPLHAAPVYCKNVSVQRGLHKHLLLAPSDVAGWGIFLK
EAAHKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANH
SINPNCYAKVMMVNGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEFL
*(78 a.a.)

- SilkBase 1999-2023 -