SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG1951_internal:A_BomoMG_comp21052_c1_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
PREDICTED:_mediator_of_RNA_polymerase_II_transcription_subunit_12_[Bombyx_mori]
Ontology
GO:0001104 F transcription coregulator activity
GO:0001105 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0007275 P multicellular organism development
GO:0007406 P negative regulation of neuroblast proliferation
GO:0016592 C mediator complex
GO:0022416 P chaeta development
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0035072 P ecdysone-mediated induction of salivary gland cell autophagic cell death
GO:0036011 P imaginal disc-derived leg segmentation
GO:0045498 P sex comb development
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048749 P compound eye development
GO:0070847 C core mediator complex
RNA-seq EntryA_BomoMG_comp21052_c1_seq1
Sequence
(Amino Acid)
HNSSGNAPGNSTPNSTVPNSLHSPGNSANMGSSTPGNESTDWRQALKLWHYCCRLAKYLL
DEGLLDRHDFLTWVIELLDKRMPDDGLLRLFLPLTLQHMN
(32 a.a.)

- SilkBase 1999-2023 -