SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG1949_internal:A_BomoMG_comp21047_c0_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
PREDICTED:_cyclin_E_isoform_X1_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000278 P mitotic cell cycle
GO:0001932 P regulation of protein phosphorylation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006275 P regulation of DNA replication
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007096 P regulation of exit from mitosis
GO:0007155 P cell adhesion
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0007277 P pole cell development
GO:0007307 P eggshell chorion gene amplification
GO:0007400 P neuroblast fate determination
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0008360 P regulation of cell shape
GO:0016538 F cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019908 C nuclear cyclin-dependent protein kinase holoenzyme complex
GO:0035019 P somatic stem cell population maintenance
GO:0035736 P cell proliferation involved in compound eye morphogenesis
GO:0042127 P regulation of cell population proliferation
GO:0043065 P positive regulation of apoptotic process
GO:0044719 P regulation of imaginal disc-derived wing size
GO:0045035 P sensory organ precursor cell division
GO:0045859 P regulation of protein kinase activity
GO:0048477 P oogenesis
GO:0048665 P neuron fate specification
GO:0051301 P cell division
GO:0060564 P negative regulation of ubiquitin protein ligase activity
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomoMG_comp21047_c0_seq1
Sequence
(Amino Acid)
RLQLIGITCLFIAAKVEEVYPPKIAEFAYVTDGACTTEEILLEELLILKILSWSITPITI
NSWLNVYMQLASEGKSAKRRLLGESDVAANALRGYTFVFPQYSSLEFVICGQLVDLAVLH
VDVNLFSYSAVAAAAIAHTYNRELAMRVSGYKWESLSECYTWLEPF
(54 a.a.)

- SilkBase 1999-2023 -