SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG19016_complete:A_BomoMG_comp40559_c0_seq3
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
Ontology
GO:0001666 P response to hypoxia
GO:0003824 F catalytic activity
GO:0004630 F phospholipase D activity
GO:0005080 F protein kinase C binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0006629 P lipid metabolic process
GO:0006654 P phosphatidic acid biosynthetic process
GO:0009395 P phospholipid catabolic process
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016042 P lipid catabolic process
GO:0016787 F hydrolase activity
GO:0030027 C lamellipodium
GO:0030334 P regulation of cell migration
GO:0030335 P positive regulation of cell migration
GO:0031175 P neuron projection development
GO:0035091 F phosphatidylinositol binding
GO:0036465 P synaptic vesicle recycling
GO:0042383 C sarcolemma
GO:0042542 P response to hydrogen peroxide
GO:0043306 P positive regulation of mast cell degranulation
GO:0043434 P response to peptide hormone
GO:0045785 P positive regulation of cell adhesion
GO:0048017 P inositol lipid-mediated signaling
GO:0048260 P positive regulation of receptor-mediated endocytosis
GO:0050764 P regulation of phagocytosis
GO:0070290 F N-acylphosphatidylethanolamine-specific phospholipase D activity
GO:0098793 C presynapse
RNA-seq EntryA_BomoMG_comp40559_c0_seq3
Sequence
(Amino Acid)
MTFIGLSRCNYFCTGLVCAKWQERWFFVKDTFFGYIRPRDGIVKGIMLFDQGFEVSSGMY
STGMNHGLQILNQSRQMVIKCWTKRKSKEWMNYLKTVANQSARDFTYPNVHHSFAPPRPA
TPARALVDGAEYFSAAADAMELAREEIFIADWWLSPEVYMKRPALNGNYWRLDMILKRKA
AQGVKIFILLYKEVEMALGINSYYSKSRLANDNIKTTRRPACSFGRTTRRSSLSTRASPS
WGASTSATAAGTTTDTG
*(85 a.a.)

- SilkBase 1999-2023 -