SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG18945_internal:A_BomoMG_comp40549_c1_seq3
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005856 C cytoskeleton
GO:0005929 C cilium
GO:0006470 P protein dephosphorylation
GO:0006810 P transport
GO:0010633 P negative regulation of epithelial cell migration
GO:0015031 P protein transport
GO:0016023 C cytoplasmic vesicle
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0019901 F protein kinase binding
GO:0030030 P cell projection organization
GO:0030334 P regulation of cell migration
GO:0031410 C cytoplasmic vesicle
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0036064 C ciliary basal body
GO:0042995 C cell projection
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0060271 P cilium assembly
GO:0070062 C extracellular exosome
GO:1903387 P positive regulation of homophilic cell adhesion
GO:1903393 P positive regulation of adherens junction organization
GO:2000643 P positive regulation of early endosome to late endosome transport
RNA-seq EntryA_BomoMG_comp40549_c1_seq3
Sequence
(Amino Acid)
ALVQQLRDAVAADDVTALLLVTNEPPEDLFKREIEKHAPTVKILEQNLGAQENIINKLTS
LYASYGDSRRLLSEVLRKRDGLINALVTSYDTYEELLGKSQKGQEFYKKLSHNVNQLLSR
LKSTCQVQEEERAQLLSKQNTKAVTSAPGPAVPAAAAPKVPDVAGLPPTGAPRK
(57 a.a.)

- SilkBase 1999-2023 -