SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG18271_3prime_partial:A_BomoMG_comp40452_c0_seq1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
Ontology
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006955 P immune response
GO:0008047 F enzyme activator activity
GO:0008285 P negative regulation of cell population proliferation
GO:0009615 P response to virus
GO:0016020 C membrane
GO:0019899 F enzyme binding
GO:0030422 P production of siRNA involved in RNA interference
GO:0031047 P gene silencing by RNA
GO:0031054 P pre-miRNA processing
GO:0034599 P cellular response to oxidative stress
GO:0035196 P production of miRNAs involved in gene silencing by miRNA
GO:0042473 P outer ear morphogenesis
GO:0042474 P middle ear morphogenesis
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043085 P positive regulation of catalytic activity
GO:0044822 F RNA binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048705 P skeletal system morphogenesis
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoMG_comp40452_c0_seq1
Sequence
(Amino Acid)
MEGNTVHPHPSVVPGLPPGVIHGMTVHGSGPNGEHIPHGPRRRYQTRPKPNNLQRLPLDE
AAKREMESLPTKTPVSVLQELLARRGTVPKYELVQIEGMIHEPTFRYRVTVADLVAMGTG
RSKKEAKHSAAKALLDKLTGATPADQTTNGNVPETGAVVPTFEDKLMGNPVGWLQELCMS
RFWPPPSYHAENDDNVNRLSGLPHE
(67 a.a.)

- SilkBase 1999-2023 -