SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG17826_3prime_partial:A_BomoMG_comp40376_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
Ontology
GO:0002042 P cell migration involved in sprouting angiogenesis
GO:0003281 P ventricular septum development
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006935 P chemotaxis
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007507 P heart development
GO:0008285 P negative regulation of cell population proliferation
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016199 P axon midline choice point recognition
GO:0021836 P chemorepulsion involved in postnatal olfactory bulb interneuron migration
GO:0021891 P olfactory bulb interneuron development
GO:0030154 P cell differentiation
GO:0030275 F LRR domain binding
GO:0030336 P negative regulation of cell migration
GO:0030424 C axon
GO:0030673 C axolemma
GO:0033600 P negative regulation of mammary gland epithelial cell proliferation
GO:0035025 P positive regulation of Rho protein signal transduction
GO:0035385 P Roundabout signaling pathway
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0050772 P positive regulation of axonogenesis
GO:0050925 P negative regulation of negative chemotaxis
GO:0060763 P mammary duct terminal end bud growth
GO:0060976 P coronary vasculature development
GO:0070100 P negative regulation of chemokine-mediated signaling pathway
RNA-seq EntryA_BomoMG_comp40376_c0_seq1
Sequence
(Amino Acid)
MRWFIATVISIVLVSSVLSTEVDDDEPFLEILARSTIYNTGERKAIFCRGKNLVEPIKWY
SPSGKLIEAQSLKNKRVYVERIVEESGEHAPLIIQYIKIADNGNWTCRSGDLSETIQFIV
GEKVNITNRNVEREGEEGKSIVLTCEAKGHPTPVVIWYKENSRIPNDTKKYEHRADNSLE
IKNLNHADVGLYVCKVRQKALSYYTDKTVRLSVLHKPILYNNFTGTIDTTKYKTEEVYAI
(79 a.a.)

- SilkBase 1999-2023 -