SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG17760_internal:A_BomoMG_comp40359_c0_seq5
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
Ontology
GO:0000281 P mitotic cytokinesis
GO:0001669 C acrosomal vesicle
GO:0004843 F thiol-dependent deubiquitinase
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007032 P endosome organization
GO:0007049 P cell cycle
GO:0007265 P Ras protein signal transduction
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0010008 C endosome membrane
GO:0016020 C membrane
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0017124 F SH3 domain binding
GO:0019897 C extrinsic component of plasma membrane
GO:0030496 C midbody
GO:0031313 C extrinsic component of endosome membrane
GO:0036459 F thiol-dependent deubiquitinase
GO:0070536 P protein K63-linked deubiquitination
GO:0071108 P protein K48-linked deubiquitination
RNA-seq EntryA_BomoMG_comp40359_c0_seq5
Sequence
(Amino Acid)
QRLSPPACISVPEECISPGQSANVLEQNLPAASRPVWSSRASADLIVTLDWSSRAPIPGT
PLHLLRTILLKWDIKVQYARPPLALEGGYEDWLLKYPASTTNPQAQPPRPDDSMDDMLGD
IEYPSWAELSPPA
(43 a.a.)

- SilkBase 1999-2023 -