SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG17507_complete:A_BomoMG_comp40318_c0_seq3
Scaffold_idBomo_Scaf071
NCBI non-redundant
(nr)
Ontology
GO:0001919 P regulation of receptor recycling
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0007032 P endosome organization
GO:0007040 P lysosome organization
GO:0010872 P regulation of cholesterol esterification
GO:0010874 P regulation of cholesterol efflux
GO:0016020 C membrane
GO:0016049 P cell growth
GO:0031902 C late endosome membrane
GO:0032008 P positive regulation of TOR signaling
GO:0032418 P lysosome localization
GO:0032439 P endosomal transport
GO:0032947 F molecular adaptor activity
GO:0034613 P cellular protein localization
GO:0042632 P cholesterol homeostasis
GO:0043410 P positive regulation of MAPK cascade
GO:0043547 P positive regulation of GTPase activity
GO:0045121 C membrane raft
GO:0060620 P regulation of cholesterol import
GO:0071230 P cellular response to amino acid stimulus
GO:0071986 C Ragulator complex
RNA-seq EntryA_BomoMG_comp40318_c0_seq3
Sequence
(Amino Acid)
MLYENVINERTHLLEVTEQQQETLIPVVSASTPPRKPDEQTALNRILHETANNVIDVGAL
GPYTLEASAYSERVRVYTARVAAVSVAAPRPAPRLLADVTHAERVALLSCPPIPAADKEL
ISGAVRRAAAAISELRVEHREDLVVPFRVP
*(49 a.a.)

- SilkBase 1999-2023 -