SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG17088_5prime_partial:A_BomoMG_comp40266_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0001948 F protein binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005791 C rough endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006895 P Golgi to endosome transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007589 P body fluid secretion
GO:0008152 P metabolic process
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0009790 P embryo development
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0016324 C apical plasma membrane
GO:0019003 F GDP binding
GO:0030133 C transport vesicle
GO:0030140 C trans-Golgi network transport vesicle
GO:0030659 C cytoplasmic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0031901 C early endosome membrane
GO:0032456 P endocytic recycling
GO:0032880 P regulation of protein localization
GO:0042175 C nuclear outer membrane-endoplasmic reticulum membrane network
GO:0045176 P apical protein localization
GO:0045335 C phagocytic vesicle
GO:0046907 P intracellular transport
GO:0048471 C perinuclear region of cytoplasm
GO:0055037 C recycling endosome
GO:0061024 P membrane organization
GO:0090387 P phagolysosome assembly involved in apoptotic cell clearance
GO:0097208 C alveolar lamellar body
RNA-seq EntryA_BomoMG_comp40266_c0_seq1
Sequence
(Amino Acid)
YRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLDAQRDVTYEEAK
QFADENGLMFVEASAKTGQNVEEAFLETAKKIYQSIQDGRLDLNAAESGVQHKPASPGRP
LAAPPSSRDNCAC
*(43 a.a.)

- SilkBase 1999-2023 -