SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG16893_internal:A_BomoMG_comp40238_c0_seq6
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005795 C Golgi stack
GO:0006810 P transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006891 P intra-Golgi vesicle-mediated transport
GO:0006909 P phagocytosis
GO:0007030 P Golgi organization
GO:0007269 P neurotransmitter secretion
GO:0007274 P neuromuscular synaptic transmission
GO:0008021 C synaptic vesicle
GO:0008152 P metabolic process
GO:0015031 P protein transport
GO:0016082 P synaptic vesicle priming
GO:0016192 P vesicle-mediated transport
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0031629 P synaptic vesicle fusion to presynaptic active zone membrane
GO:0032403 F protein-containing complex binding
GO:0035494 P SNARE complex disassembly
GO:0043001 P Golgi to plasma membrane protein transport
GO:0043195 C terminal bouton
GO:0046872 F metal ion binding
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0048211 P Golgi vesicle docking
GO:0098527 C neuromuscular junction of somatic muscle
GO:1900073 P regulation of neuromuscular synaptic transmission
RNA-seq EntryA_BomoMG_comp40238_c0_seq6
Sequence
(Amino Acid)
RAAQSTAMNRLIKASSKVEVDPEAMEKLMVERTDFLHALENDIKPAFGTSAEALEHFLAR
GIVNWGSPVSSIFEDGQLYIQQARATEASGLVSVLLEGPPNSGKTALAAQLAK
(36 a.a.)

- SilkBase 1999-2023 -